PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6AL_477C798AB.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YB
Protein Properties Length: 163aa    MW: 17628.8 Da    PI: 6.5319
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6AL_477C798AB.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB123.11.1e-3826115695
                  NF-YB   6 rflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93 
                              lP+anv+r+m++vlP+n ki++ ak+++++c++ef++fv++eas++++ e+r+t++++d+ w+  +lG++ yv+p+++yl+ yre 
  Traes_6AL_477C798AB.1  26 SALPMANVVRLMRRVLPSNVKIAETAKQLTHDCAVEFVGFVGGEASERARSEHRRTVAPEDFTWSCQSLGLDSYVQPMQTYLQGYREY 113
                            689***********************************************************************************98 PP

                  NF-YB  94 eg 95 
                            + 
  Traes_6AL_477C798AB.1 114 DI 115
                            75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.5E-2924121IPR009072Histone-fold
SuperFamilySSF471131.71E-2327117IPR009072Histone-fold
PfamPF008083.6E-152888IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.2E-65573No hitNo description
PRINTSPR006152.2E-67492No hitNo description
PRINTSPR006152.2E-693111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MGGSSKKRGG QRGEGDAENP AAEGGSALPM ANVVRLMRRV LPSNVKIAET AKQLTHDCAV  60
EFVGFVGGEA SERARSEHRR TVAPEDFTWS CQSLGLDSYV QPMQTYLQGY REYDIARGRS  120
SRGARPPAPP AIASFLPPGQ PVTVTEEELE FLRSVVPPPP EGY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A5e-2523112493NF-YB
4csr_A6e-2523112594NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B6e-2523112594NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006649006.12e-46PREDICTED: nuclear transcription factor Y subunit B-1-like
SwissprotQ6Z3482e-43NFYB1_ORYSJ; Nuclear transcription factor Y subunit B-1
TrEMBLW5G6R11e-116W5G6R1_WHEAT; Uncharacterized protein
STRINGMLOC_75867.11e-102(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP136592631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.14e-22nuclear factor Y, subunit B3
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]